SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007984 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007984
Domain Number 1 Region: 264-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 676-856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.71e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 481-672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-36
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 4 Region: 71-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 5 Region: 889-1038
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-29
Family Laminin G-like module 0.000000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007984   Gene: ENSDORG00000008504   Transcript: ENSDORT00000008505
Sequence length 1305
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5759:59794:942857:-1 gene:ENSDORG00000008504 transcript:ENSDORT00000008505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDCSRTGFRGKDCSQDIKYSFLCISSMLLSDNDQRKCFMNTGEPENKKDNNVEGLAHLMM
GDQXXXXXKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADY
VNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQXXXXXXXXXXXX
XXXVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVY
KNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGS
ISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKI
KALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKA
GLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSN
PCKNNVMCRDGWNRYVCDCSGTGFLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVS
LRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYN
LNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPS
NFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQA
YTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPL
NDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLV
HAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWD
GFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEA
VLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGN
ATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXSGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGS
YHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV
Download sequence
Identical sequences ENSDORP00000007984 ENSDORP00000007984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]