SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008007 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008007
Domain Number 1 Region: 474-601
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.27e-29
Family Ankyrin repeat 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008007   Gene: ENSDORG00000008528   Transcript: ENSDORT00000008528
Sequence length 720
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3686:14114:68631:-1 gene:ENSDORG00000008528 transcript:ENSDORT00000008528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEAQALDWDSDETVIEGSVTESDPEDEELPWKXXXXXXXXXXXXXXXXXXXXXXXXXX
MLSEIKLGMKFRKDLQEQMNKNKMMPILSSDTVLQHQDETTLNQGLLQIKKHFPGSNLSF
FQSGLSLYHQNIGGPEAENTEILLCPEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVEDPNLFRLQTLAHPDMTSYE
PLNNMEKSNLVENISEQETPCVLRRSSRLEKLKVSREAKHEDTMCKSSEKIIPKILSSEE
QINNKSSTENFRVKHLALRMDSKEMNKHSSRLKAEHIRKNEQLEIKKEKMKSNKKSFASI
NRRNIFGENLIYKAALDNDVHLVRHCIKNGGNVNQPCYAGWTALHEASVGGFYQIVSELL
KGGADVNTKGMHQITPLHDAVINGHHKVAELLLLNGADPLFRSDNGKCPWDEAKDSRMKH
LLEKYIPKDDKCLKSAHSDGTHRVDVEDVHQHKKPKFSSKTCSESVSNENSNRYKPEHEE
VNKERNEGLPISNEDIYERFTNNSTTTNFGRSKPRQSSVNQIYTRELRKRNIKDTSTNVS
Download sequence
Identical sequences ENSDORP00000008007 ENSDORP00000008007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]