SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008034 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008034
Domain Number 1 Region: 29-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.68e-19
Family Pentraxin (pentaxin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008034   Gene: ENSDORG00000008555   Transcript: ENSDORT00000008556
Sequence length 3056
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4258:17953:122821:1 gene:ENSDORG00000008555 transcript:ENSDORT00000008556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEHIVYQRLYGLLLMSSFIFLSDPLSLKGKRLDFYGRSDRYVSLTNSIPELSRFTACID
LVSMADRSTYWMAFSYIAKNTLLGREDIHLGLAGNQKQLILYSLGKAFYISHHLTPFHWH
TICLIWDGVKGKLELFVDKERILIIMDQPHSLTANGTLVLGHLPKNGKGQVKSVAPHFTG
SLYYFQLWDRILEHEEFTRCLDGNIVSWEEDIWLVHKIIPTFDRRLRCFVSENMTVQETS
TTLSQQIHLTTPSQITALSPQKTIYSSTIMSKSMPIFITNHTNISHSNTTSPPLVTMTLS
KSLKTSIADTATFTNVLSNSTMITLPSQSTLNCTTTDSMKITEHSSSESTRTTKMVEAVA
PETFQPTRATHLFSIPGVTINPFLSKTSTDSQTTSMNTLFTTIKSTFMSATSWPVHKSTD
TSALPIATPTQEFLVSTAAKTSAVTTGIGTSLASPTDLITSTDAPVDSVFPTTQVPPTLA
TTEMEITFTVNLGMSTETTSGSRPVEIEWTPSHVHDASLSSKEDAISTFMLRRTSSMTLS
SMMAPPITGTQSTQTVTDNEGSYTAFTPRITLSPXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETSMEKSIPIYQMSSLPF
NATFISKNMSDTPTVSVTRSSKTTQMGCLKSPSPDTSGLTSEMSTVPVNDPSFSSTAVPS
VPAITGQPLSTLLSSVSPMTTTAIQTSTLDVIPVTYTEHTSEHTTMASSTFTNSEMTQVS
SKIMPTSVSSPTKPNFPSTKTIPTTIVDRTVTPLIDTITFSPLHSKNTEAISSIPHTTFS
PLLSTTQQSSDEATTLSLLPGITFRSQSTVSSGKMTVFKHTYSGISVPENVFSPTPSNDL
HTSLDIQVSKPSTSFKSTPGPTENAQTITTYLSSNTGKVTSSSKSTFLTSYAPSVNTSVL
YLPWTSSSANLPSSTSLLYALRSTVTMLSTSKTSFPPTAQMVEFPVLGTQITSSDTRSLL
TTSWKTPTAKDSPFPISTKTLMPTPKIETDTLHFIPGSLSTFASSQAGLVSSDAMTTLSI
PTSEMLPTFGFSENHSLSVSSRALPTTSSDIKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSFETTWPDSTSTFLSTEALTLSAATA
SIVSFYNIKMSFSVFDEETRIPITSVIHEFTKDWLNSIFQDSEFYLTNLAIQIKSDTSKE
EMAMYRYILGQREGQEMATISHVPYSCACQVIIKANSSLPPMDLISRIKRKIHGNFTHGS
FTQDQLTLLVKSDHVIVKKLEPGKCEADDTPSIYKGTYQWLLTDPTETAQSRCIKNKNGN
ATRICSISIQTGKSLWEKPRFKQCKLLQGLPDKIVDLANVTISDENADDVAEHILNLVKE
ASLLDEEETRIIVSKVADISKCDEISMKLTQIILQIINVVSEKQSDLTSNLHPVSNVILR
TIERAGHKIEFSGRTANITVGGLALAVLRMDHRFEGMAFSICSYEVTAPEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTSLFKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNYDQVYCAFWDFATNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDLSRSTVDAVNERILMIITYTGCGISSIFLGIAMVTYIAFHKLRKDYPSILILC
TALLMLNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIPAITVAVILSVRKDLYGTMSPTTPFCWIKDDSIFYISVVAYFGL
IFLMNLSMFCTVLAQLNSVKFQGQKSRRKMILHDLKGTISLTFLLGLTWGFAFFAWGPVR
IFFMYLFAICNTLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSSRRGIHVGC
KQERLKKTLEHKLLTPSLKSIASSCTFKSIGSAQGPPSEISFSNDDFDEDPYCFSP
Download sequence
Identical sequences ENSDORP00000008034 ENSDORP00000008034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]