SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008065 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008065
Domain Number 1 Region: 65-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008065   Gene: ENSDORG00000008591   Transcript: ENSDORT00000008591
Sequence length 169
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2427:18205:33650:1 gene:ENSDORG00000008591 transcript:ENSDORT00000008591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSAGRRMETHPSSLVQALLLCLGFHLLPAVLGTTVIPSCMPGESDNNCTALVQKEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSENYCXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXYKNRKSKKSKKEYERVTSGDPVLPQV
Download sequence
Identical sequences ENSDORP00000008065 ENSDORP00000008065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]