SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008084 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008084
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily L domain-like 6.8e-28
Family U2A'-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008084   Gene: ENSDORG00000008611   Transcript: ENSDORT00000008612
Sequence length 231
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_1713:87426:90618:-1 gene:ENSDORG00000008611 transcript:ENSDORT00000008612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKELVLDNCRATEGKIDGLTDEFKELEFLSTINIGLASVANLPKLNKLKKLELSDNRITG
GLDVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRESVFEL
LPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDDEEDEDEEEYEEDAQVVEDEEDEDEEEEG
EEEDVSGEEEEDEEGYNDGEVDDEEDEEDLGEEEKGQKRKREPEEEGEEDD
Download sequence
Identical sequences ENSDORP00000008084 ENSDORP00000008084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]