SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008093 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008093
Domain Number 1 Region: 27-126
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.24e-26
Family Leukotriene A4 hydrolase catalytic domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008093   Gene: ENSDORG00000008622   Transcript: ENSDORT00000008622
Sequence length 651
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5000:3968:15871:-1 gene:ENSDORG00000008622 transcript:ENSDORT00000008622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFNAALKMSTYVMAVIVRELHYIQVFSPNNVLIRIWARPSAMAKVHGDYALNVTGPILNF
FANHYNTSYPLEKSDQIGLPDFNAGAMENWGLVTYRENALLFDPQSSSIGNKERVVTVIA
HELAHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXAVDSQQEIQLPDSVGTIMDRWILQMGFPVITVNTETGNISQQHF
LLDPESNVTRPSDFNYLWIVPITSLKKGAQQDSYWXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYLRKQVTPLYHYFKDLTGNWTQRPAT
LMEXXXXXXXXXXXXXXXXXXXXXXXXXXFKQWMDNPSQNPIHPNLRSTVYCNAIAQGGE
VEWNFAWEQFRNATLVNEADKLRAALACSNQVWILNRYLSYTLNPDYIRKQDATSTINSI
ASNVVGQTLVWDFVQSNWKKLFEDYGGGSFSFANLIQAVTRRFSTEYELQQ
Download sequence
Identical sequences ENSDORP00000008093 ENSDORP00000008093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]