SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008105 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008105
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.67e-32
Family Ankyrin repeat 0.0009
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008105
Domain Number - Region: 439-574
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0112
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008105   Gene: ENSDORG00000008637   Transcript: ENSDORT00000008637
Sequence length 718
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2517:12638:38230:-1 gene:ENSDORG00000008637 transcript:ENSDORT00000008637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKRPWIQLQKLLSWLTGEQDWDQNLDNLYMLQQKRIWEAPLLRAAKEHDLCTLKRLLL
DPKCDFQQRGALGETALHIAALYDNLEAAMALMEAAPDLVTEPIVCEPFVGQTALHIAVM
NQNVNLVRALLARGASVSARATGFAFHLSPHNLIYYGEHPLSFAACVGSEEIVRLLIEHG
ADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLQSLELVPNHQGLTPFKLA
GVEGNTVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSWREELSFLELVVSSKKREARQI
LEQTPVKELVSLKWKKYGRPYFCVLGALYILYMICFTACCVYRPLKFRDGNRTSSRDNTI
LEQKLLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXITYASLVLVTMVMRLTNVNGEVVPISLALVLGWCSVMYFTRGFQMLGPFTIMIQKMIF
GDLMRFCWLMAMVILGFASAFYIIFQTEDPANLGEFSNYPTALFSTFELFLTIVDAPANY
SVDLPFMYSITYAAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVMLERKMPRFL
WPRSGICGCDYGLGDRWFLRVESHHDQNPFRMLRYVEAFKCPDKEDGQEQLSEKRPSIAE
SEILARSSLIFQTPSLSRTTSQSSSSHRGWEILRRNTLGHLNIGLDLGEGDGEEIYHF
Download sequence
Identical sequences ENSDORP00000008105 ENSDORP00000008105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]