SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008110 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008110
Domain Number 1 Region: 75-723
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.64e-149
Family Neutral endopeptidase (neprilysin) 0.000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008110   Gene: ENSDORG00000008641   Transcript: ENSDORT00000008642
Sequence length 723
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2517:43888:63218:-1 gene:ENSDORG00000008641 transcript:ENSDORT00000008642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGDQSGEELREESPATGMALPQSQEVSAEEGQPAEWSRHKAMTRRALITLLLGLLIGF
SVLVYVFWSCGXXPCESPVCLELRYLAGNTSVAPCEDFFSFACGGKANGTSHFQALAEEN
KSRLQRLLEAPGSWHPGSGEEKTFQFYKSCMDTEAIEAAGAGPLRQVIEELGGWNFSGNW
TSLDFNRTLRLLMSQYGHFPFFRAHLRPHPSPPHTLVIQIDQPEFDIPLKQEQEQKIYAQ
IFRAYLTYLNRLGTLLGGDPEHVQRHASLSLTITSRLSQFRRPLEQQQAQDKFFNNITID
QLQEMAPAIDWLSCLQATFTQMSLTPSQPLVVHDLDYLRNMSQLLLSHRDCLQSHMIFGL
VGILSPALDSKFQDARRELTQKLLELTEGPPMPAQPRWMKCVEKTGTFFEPTLAALFVRE
AFGQRMQSAATELFTEIKDALVLYLKKLPWISEETRKETLDRVTQLKVEMGAPQWALKPE
VASXXXXXIQIGPSFLQFLLSSVRSLRARNVQSLLQPFSSHRWQVSPWAVNAYYSRTDHV
LVFPAGLLQPPFFHPDYPRAVNFGAAGIIMAHKLLNISHQHLLPGGFQACDPHALQEVLL
CLENHYAAFPLSIRPSFNSCHPLLENTADMVGLAIALQAYSKRLLLYRGETTLPGKAFTP
HQLFFRSYAQVMCGELNTQDARDTHSPPSLRVNGPLSNHPAFASNFHCPHGTPMNPSSHC
QFW
Download sequence
Identical sequences ENSDORP00000008110 ENSDORP00000008110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]