SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008146 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008146
Domain Number 1 Region: 134-241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-16
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 273-423
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000237
Family Nucleotide and nucleoside kinases 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008146   Gene: ENSDORG00000008678   Transcript: ENSDORT00000008678
Sequence length 567
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5080:26187:35036:-1 gene:ENSDORG00000008678 transcript:ENSDORT00000008678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDQDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPPPPEEEAKDEE
EDQTLVNLDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAQ
NLPMKEGCAEVSLLRVGWSIDFSHPQLGEDEFSYGFDGRGLKAENGQFEEFGQTFGENDV
IGCFANFETEEVELSFSKNGEDLGVAFRINKESLADRALLPHVLCKNCVVELNFGQKEEP
FFQPPEEFVFIHAVPVEERVRTAVPPKTTEECEVILMVGLPGSGKTQWALNYAKENPEKR
YNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQCNV
YNSGQRRKLLLFKTFSRKVVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLPE
KCDYMDEVTYGELEKEEAQPIVTKYKEEARKLLPPSEKRTNRRNNRNKRNRQNRSRGQGY
VGGQRRGYDNRAYGQQYWGQSGNRGGYRNFYDRYRGDYDRFYARDYEYNRYRDYYRQYNR
EWQNYYYHHPQDRDRYYRNYYGYQGYR
Download sequence
Identical sequences ENSDORP00000008146 ENSDORP00000008146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]