SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008148 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008148
Domain Number 1 Region: 23-257,287-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-69
Family G proteins 0.00000058
Further Details:      
 
Domain Number 2 Region: 305-386
Classification Level Classification E-value
Superfamily TGS-like 4.36e-36
Family G domain-linked domain 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008148   Gene: ENSDORG00000008681   Transcript: ENSDORT00000008680
Sequence length 396
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3218:17850:139967:-1 gene:ENSDORG00000008681 transcript:ENSDORT00000008680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKAGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLK
PEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKK
NKWLIKIKEWVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALPKIIKAGF
AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYDDFKEEGSEN
AVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK
Download sequence
Identical sequences ENSDORP00000008148 ENSDORP00000008148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]