SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008149 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008149
Domain Number 1 Region: 689-863
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-44
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 468-621
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-26
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 865-996
Classification Level Classification E-value
Superfamily TPR-like 1.34e-22
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008149   Gene: ENSDORG00000008682   Transcript: ENSDORT00000008681
Sequence length 1610
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5288:13363:100367:1 gene:ENSDORG00000008682 transcript:ENSDORT00000008681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQIASDSPHASPKHVDANRELPLTQPPSAHSSITSGSCPGTPEMRRRQEEAMRRLASQV
VAYHYCQADNAYTCLVPEFVHNVAALLCRSPQLTAYREQLLREPHLQSMLSLRSCVQXXX
XXXXXXXXXXXXXXXXXRKIPDEDFIILIDGLNEAEFHKPDYGDTIVSFLSKMIGKFPSW
LKLIVTVRTSLQXXXXXXXXXXXXXXRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNG
KMDNTTFGKLSSHLKTLSQGSYLYLKLTFDLIEKGYLVLKSSSYKVVPVSLSEVYLLQCN
MKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAINAGNIEGTLEWEDFQQRMENLSMFL
IKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIEL
GHHILKAHIFKGLSKKVGVSSSILQGLWISYSTEGLSMALASLRNLYTPNIKVSRLLILG
GANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGYAAAAGFLS
IVMLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQ
QALIAAASMGYTEIVSYLLDLPEKDEEEVERAQINSFDSLWGETXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVDLLLTHGADVNMADKQGRTPLMMAASEGH
LGTVDFLLAQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDL
AAFYGDAEVVQFLVDHGAMIEHVDYSGMRPLDRAVGCRNTSVVVTLLKKGAKIGCQTLPS
RPRGPATWAMATSKPDIMIILLSKLMEEGDMFYKKGKVKEAAQRYQYALKKFPREGFGED
LKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSYEAYYARARAKRSSRQFA
AALEDLNEAIKLCPNNREIQRLLIRVEEECRQMQQQQQQPPPPSQQPQQDLPEETEPEPQ
HEDIYSVQDIFEEEYLEQDAENVSIGLQTEARPSQGLPIIQSPPSSPAHRDSAYISSSPL
GSHQVFDFRSNSSVGSPTRQGYQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPP
VGGQSKEYPSPPPSPLRRGPQYRASPPAESMSVYRSQSGSPVRYQQETNVSQLPGRPKSP
LSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSSAVHSSTVIPTGAYGQVAHSM
ASKYQSSQGDMGVSQSRLVYQGSIGGIVGDGRPVQHVQASLSAGAICQHGGLTKEDLPQR
PSSAYRGGMRYSQTPQIGRSQSASYYPVCHSKLDLERSSSQLGSPDVSHLIRRPISVNPS
EIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPAYDRSC
DELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPT
SPGNLPQPESFSPPSSISNIAFYNKTNNAQNGHLLEDDYYSPHGMLANGSRGDLLERVSQ
ASSYPDVKVARTLPVAQAYQDNLYRQLSRDSRQGQTSPIKPKRPFVESNV
Download sequence
Identical sequences ENSDORP00000008149 ENSDORP00000008149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]