SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008153 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008153
Domain Number 1 Region: 689-1050
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.22e-142
Family Neurolysin-like 0.00000000000816
Further Details:      
 
Domain Number 2 Region: 373-484
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.22e-46
Family Neurolysin-like 0.00000947
Further Details:      
 
Domain Number 3 Region: 1095-1167
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.21e-29
Family Neurolysin-like 0.0000158
Further Details:      
 
Domain Number 4 Region: 50-138
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000022
Family Neurolysin-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008153   Gene: ENSDORG00000008685   Transcript: ENSDORT00000008685
Sequence length 1167
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5288:143806:165243:1 gene:ENSDORG00000008685 transcript:ENSDORT00000008685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAGRPREPRLLATLLPLLLQLLPPTRAALDSGLQPGNFSADEAGAQLFAESYNSSAEQV
LFQSMAASWAHDTNITAENARRQEEAALLSQEFEEAWGQKAKELYESMWQNFTDPKLRRI
IEAVRTLGPANLPLVKLQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIKQCTRVTMDQLSTVHHEMGHVQYFLQYKDLPVSLRRGANPGFHEAI
GDVLALSVSTPVHLHKIGLLDHVTNDTESDINFLLKMALEKVAFLPFGYLIDQWRWRVFS
GQTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXMQSNMQVANHTLKYGTWAKQFDVSHFQNATNKRI
IKKVQDLDRAALPVKELEEYNQILLDMETTYSVASVCHINGTCLQLEPDLTNIMATSRNY
EQLLWVWKSWRDQVGKTILPFFPKYVELANKAARLNGYTDAGDSWRSMYETPSLEQDLEK
LFQELQPLYLNLHAYVRRALHRHYGDQSISLEGPIPAHLLGNMWSQTWSNIYDLVVPFPS
APKIDATEAMVKQGWTPRRMFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVNMEELVVAHHEMGHIQYFMQYKDLPVAFREGANPGFHEAIGD
VLALSVSTPKHLHSINLLEHEGGGYEYDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLKYQGLCPPVPRTQDDFDPGAKFHVPSSVPYIRYFISFIIQFQFHE
ALCQAAGHKGPLHKCDIYQSKEAGKLL
Download sequence
Identical sequences ENSDORP00000008153 ENSDORP00000008153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]