SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008157 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008157
Domain Number 1 Region: 7-231
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-87
Family Eukaryotic proteases 0.000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008157   Gene: ENSDORG00000008690   Transcript: ENSDORT00000008689
Sequence length 233
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6636:32729:34903:1 gene:ENSDORG00000008690 transcript:ENSDORT00000008689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPLNKHDKIVGGYTCRKNSLPYQVSLNNGRAHFCGGSLIHDQWVVSAAHCYRPSIQVRL
GEHNIKVIEGEEQFIEAAKIIPHPAFNRKSADNDIMLIKLSSPASLNSQVAPVALPTSCA
PAGTQCLISGWGNILRLGVYKPSLLQCLYAPLLNQSVCEAAYPGKITNNMVCAGFLEGGK
DSCQGDSGGPVVCSGELQGIVSWGNGCALKNSPGVYTKVCKYLDWIQDTIAAN
Download sequence
Identical sequences ENSDORP00000008157 ENSDORP00000008157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]