SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008161 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008161
Domain Number 1 Region: 36-256
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-34
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008161   Gene: ENSDORG00000008692   Transcript: ENSDORT00000008693
Sequence length 722
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6636:125976:139488:-1 gene:ENSDORG00000008692 transcript:ENSDORT00000008693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWSLPKEKGLILCLWNKLCKWSHRQESWTQSRDEQNLLQQKRIWESPLLLAAKENDVQT
LSKLLKYQGCDVHQRGAMGETALHIAALYDNLAAMLLMEAAPELVFEPMQEGQTALHIAV
MNQNVNLVRALLARGASVSARATGFAFHLSPHNLIYYGEHPLSFAACVGSEEIVRLLIEH
GADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLQSLELVPNHQGLTPFKL
AGVEGNTVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDEQSLLELIVTTKKREARQ
ILDQTPVKELVSFKWKRYGRPYFCVLGAIYLVYIICFTMCCVYRPLKPRTTNRTNPRDNT
LLQQKLLQEAYVTPKDDLRLVGELVTIIGAVIILLVEIPDIFRLGVTRFFGQTILGGPFH
VIIITYAFTVLVTMVMRLTNTDGEVVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMI
FGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPAN
YDVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVATTVMLER
KLPRCLWPRSGICGRDYGLGDRWFLRVEDRQDLNRQRILRYAQAFQPQDALCSEDLDKDS
GEKLELGRPFGPYLSFPTPSVSRSTSRSSTNWERLRQGTLRRDLRGIINRGVEDGEGWEY
QV
Download sequence
Identical sequences ENSDORP00000008161 ENSDORP00000008161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]