SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008177 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008177
Domain Number 1 Region: 218-271
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000101
Family Eukaryotic proteases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008177   Gene: ENSDORG00000008712   Transcript: ENSDORT00000008712
Sequence length 394
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1289:27796:33820:-1 gene:ENSDORG00000008712 transcript:ENSDORT00000008712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPVALLSGDGELRGMLLVLLYVSHTAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEPGNPMMCQLQEFDLWVLRGL
LTPGGDQCPGLFLYTKVEDYSDWIMSKARKAGPSLFSLHPWEKLIPATYHQPSALFPLST
YPAPHPMAWSHSQEPDRTTVHLVPANGSGDSSQAFKVKGIQDADRHSEGASQPVYYDYYG
GEAGEETTAGQSRLRQPQAMSFVFFVLVFFGSGA
Download sequence
Identical sequences ENSDORP00000008177 ENSDORP00000008177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]