SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008204 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008204
Domain Number 1 Region: 65-182
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-31
Family Ankyrin repeat 0.00084
Further Details:      
 
Domain Number 2 Region: 455-515
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000083
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008204   Gene: ENSDORG00000008741   Transcript: ENSDORT00000008741
Sequence length 526
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_30568:1784:7720:-1 gene:ENSDORG00000008741 transcript:ENSDORT00000008741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRLPGRSAPSVCGGRGWRPWPPPPGPLPEPHASALTLLPSPSGGTSLRPPPPTPAKSGAM
NDQYHRAARDGYLELLKEATRRELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGSDPDKC
DIWGNTPLHLAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSIA
AKQSSLNPKLVGKLKDKAFREAERRMRECAKLQRKHHERMERRYRRELAERSADALSFSS
LTSAGTLSRRPHHGPAPASQLPYSQATLHGTAKGKTKIQKKLERRKQGGGGGEGTFKVSE
DGRKSVRSLSGVQLGSDVMFVRQAPYANPKEWGRAPLRDMFLSDEDSVSRATLAPEPAHS
EVSTDSGHDSLFTRPGLGTMVFRRNYLSSGLHGLGRDDAGLEGAGTPRGRLHSSPSLDDD
SLGSANSLQERSCGDELPWDELDLGLDEDLEPETSPLETFLASLHMEDFTPLLRQEKIDL
EALMLCSDLDLRSISVPLGPRKKMLGAVRRRRQVLERPPALEDTEL
Download sequence
Identical sequences ENSDORP00000008204 ENSDORP00000008204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]