SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008242 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008242
Domain Number 1 Region: 29-244
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.52e-38
Family Dienelactone hydrolase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008242   Gene: ENSDORG00000008783   Transcript: ENSDORT00000008782
Sequence length 245
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_3022:1918:10405:1 gene:ENSDORG00000008783 transcript:ENSDORT00000008782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANEAQPCPCDIGHRLEYGGLGREVQVGHIQAYVTRSPVDAGKAVVIIQDIFGWKLPNTR
YMADMIAGNGYTTLVPDFFVGQEPWSPSGDWSTFPEWLKTRNARHVNREFDAALKYLKDQ
CHAQKIGVVGFCWGGVAVHHIMATYSEVRAGVSLYGIVRDSEDVYNLKNPTLFIFAENDA
VIPLEQVSLLTQKLKEHCKVEYQIKTFSGQTHGFVHRKKEDCLPADKPYIDEARRNLIEW
LNKYV
Download sequence
Identical sequences ENSDORP00000008242 ENSDORP00000008242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]