SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008287 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008287
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000011
Family C-type lectin domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008287   Gene: ENSDORG00000008834   Transcript: ENSDORT00000008832
Sequence length 130
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5373:1092:3582:-1 gene:ENSDORG00000008834 transcript:ENSDORT00000008832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSQPCPRSWSRHGASCYRLVWSLDSWNGSRRRCSRLDSALLAIESPEEFXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPVRSAATQEGRTCAWIHGSDIYAQLCHTP
AFSICKRLSV
Download sequence
Identical sequences ENSDORP00000008287 ENSDORP00000008287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]