SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008302 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008302
Domain Number 1 Region: 291-388
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.57e-42
Family GDI-like 0.00000365
Further Details:      
 
Domain Number 2 Region: 1-45,111-333
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-39
Family GDI-like N domain 0.0000000118
Further Details:      
 
Domain Number 3 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.34e-16
Family GDI-like N domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008302   Gene: ENSDORG00000008848   Transcript: ENSDORT00000008848
Sequence length 447
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_549:11883:18627:1 gene:ENSDORG00000008848 transcript:ENSDORT00000008848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEMARCKQLICDPSYIPDRVRKAGQVIRI
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETA
EPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGSAFDFENMKRKQNDVFGEADQ
Download sequence
Identical sequences ENSDORP00000008302 ENSDORP00000008302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]