SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008319 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008319
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000142
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008319   Gene: ENSDORG00000008865   Transcript: ENSDORT00000008865
Sequence length 588
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3310:72394:102382:1 gene:ENSDORG00000008865 transcript:ENSDORT00000008865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARDARGQFPLHLLVWNNDYRQLEKELRDQNVEALDPRGRTLLHLAVSLGHLESARVL
LRHKADVTKENGQGWTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAP
DFYVQMKWEFTSWVPLVSRICPNDVCRIWKSGAKLRVDITLLGFENMSWIRGRRSFIFKG
EDNWAELMEVNHDDKVVTTEHFDLSQEMERLTLDLMKPKSREVERRLTSPVINTSLDTKN
IAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVSVITKIRTEHLTEEEKKRYKADRNPL
ESLLGTVEHQFGAQGDLTTECATANNPTAITPDQYFDEDFDLKDRDIGRPKELTIRTQKF
KATLWMCEEFPLSLVEQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLN
ARITFGNVNGCSTAEESQNVEGTQADSASQVTNFEVDQSVFEIPESYHVQDNGRNVHLQD
EDYEIMQFAIQQSLLESSRSQELSGPASNGGISPTHSYEAQYERAIQESLLTNMEGLCPG
ALNESSRFDSDLQLAMELSAKELEERELRLQEEEAELQQVLQLSLTEK
Download sequence
Identical sequences ENSDORP00000008319 ENSDORP00000008319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]