SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008320 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008320
Domain Number 1 Region: 245-375
Classification Level Classification E-value
Superfamily ApaG-like 9.29e-41
Family ApaG-like 0.00024
Further Details:      
 
Domain Number 2 Region: 64-231
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.67e-22
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008320
Domain Number - Region: 1-46
Classification Level Classification E-value
Superfamily F-box domain 0.000218
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008320   Gene: ENSDORG00000008866   Transcript: ENSDORT00000008866
Sequence length 432
Comment pep:novel scaffold:dipOrd1:scaffold_4843:1952:29223:1 gene:ENSDORG00000008866 transcript:ENSDORT00000008866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCYVSRRLSQLSTHDPLWRRHCKKYWLISEEEKTRKRQCWKSLFIDTYCDVGRYIDHYAA
IKKAWDDLKKYLEPRCPRMVMSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLV
VPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEG
RNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVNNVVSGSFPIIRDQIFRYIHDP
ECVATTGDITVSVSTSFLPELSSIHPPHYFFTYRIRIEMSKDALPEKACQLASRYWRITN
AEGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYIFHFLYFKDKIFNVA
IPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEEEEDSPEMEETEEEEERQRRVFD
VPIRRRRCSRLF
Download sequence
Identical sequences ENSDORP00000008320 ENSDORP00000008320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]