SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008420 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008420
Domain Number 1 Region: 79-508
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.28e-99
Family Neurolysin-like 0.0000000000086
Further Details:      
 
Domain Number 2 Region: 592-674
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-20
Family Neurolysin-like 0.00000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008420   Gene: ENSDORG00000008967   Transcript: ENSDORT00000008967
Sequence length 686
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5361:15248:25248:1 gene:ENSDORG00000008967 transcript:ENSDORT00000008967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXQRNTLDFPQHVSPSKDIRTASTEADKQLSEFDVEMSMRQDVYQ
RIVWLQEKVQKDTLRPEAMRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGLPDDFLNSLEKTEDGKLKVTLKYPHYFPLLKKCHVPETRRKM
EAAFNCRCKEENCAILKELVALRAQKSSLLGFSTHADYVLEMNMARNSQSVATFLDELAR
KLKPLGEQERAVILELKQAECKKRDLPFDGCINAWDMRYYMNQVEETRYRVDQNLLKEYF
PMQVVTQGLLAIYQELLGLSFALEEGASVWHEDVRLYSVRDTASGAVIGKFYLDLYPREG
KYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTPDAPSLLQHDEVETYFHEFGHVMH
QLCSQAEFAMFSGTHVERDFVEASSQMLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNMPATFGH
LAGGYDAQYYGYLWSEVFSMDMFHTRFKQEGVLNPKVGMDYRTTVLKPGGSEDASAMLKL
FLGREPKQDAFLLSKGLQVEGSERPC
Download sequence
Identical sequences ENSDORP00000008420 ENSDORP00000008420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]