SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008422 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008422
Domain Number 1 Region: 238-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-32
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 87-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000229
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008422   Gene: ENSDORG00000008968   Transcript: ENSDORT00000008969
Sequence length 393
Comment pep:novel scaffold:dipOrd1:scaffold_35030:9890:11242:1 gene:ENSDORG00000008968 transcript:ENSDORT00000008969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDISKAFWEELTCVICLGILIDPVTIDCGHTFCRPCICFAWEEAEIPDMCPVCRGPSQ
QRDLKTNIILKHLVSIARKASLRQCLSSEEHQCEIHKEAKQTFCEVEKELLCKLCSQSPG
HRNHRHCSIEGAAEQQQELMLKQMRSLWDKIQENKRLINNTYEMLLPELQEEAKKHSDIL
KKATLQQLERRKTQMLNKNKQLRKMYQELMKTYQNPDVELLKFPCLDKNSTSTVEISFNQ
EPQNPGVMQFDYVRKLMPRHVFLNSDGSSNLTGWGVNVFSSGKHYWELSVDDSWDWALGV
CRNSGVRKNSPITDSEDIFVLLCVKGSNDSHLFTSSPFLSHYMERPVGRIGVFLDFENGN
LSFFNVAKSSLIWKYPTGFFQFPVRPFFATSHT
Download sequence
Identical sequences ENSDORP00000008422 ENSDORP00000008422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]