SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008464 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008464
Domain Number 1 Region: 104-172
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000717
Family C-type lectin domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008464   Gene: ENSDORG00000009015   Transcript: ENSDORT00000009015
Sequence length 173
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3871:69719:75127:-1 gene:ENSDORG00000009015 transcript:ENSDORT00000009015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLPLLLGTMSSLPLENGDAPHLKSPKTKTDLGQGLDGEGEQKREALTQEATQAQG
EPQALKRRNAFEEEEAMEWKPDALDKDLLCPREEDTVHVGSQECKTYHYRLVWTPDTFTA
ATLCKRCQKGKLVSIHDMNYLANAQVWVDGPLKGGGFWQGALCDTHAPFVCSS
Download sequence
Identical sequences ENSDORP00000008464 ENSDORP00000008464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]