SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008474 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008474
Domain Number 1 Region: 12-149
Classification Level Classification E-value
Superfamily C-type lectin-like 1.16e-30
Family C-type lectin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008474   Gene: ENSDORG00000009025   Transcript: ENSDORT00000009025
Sequence length 345
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5933:80474:95552:1 gene:ENSDORG00000009025 transcript:ENSDORT00000009025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVCRGGTRRPCYKVIYFHDVSRRLNFEEAKEACRWDGGQLVSIESEDEQRLIEKFIENL
LASDGDFWIGLRRREEKKSNSTACQDLYAWTDGSTSKFRNWYVDEPSCGSEVCVVMYHQP
SAPAGIGGPYMFQWNDDRCNMKNNFICKYSDVKPTAPSMRPGGERTDPITPTLAEETQKE
DTKETVKESKDTALNLAYILIPSIPLLLLLVVTTVVCAAWISRXXKREQPDPSTKDQHTI
WASPHQEPSPDLEVYNIIRKQSEADLAEPRPDLKNISFRVCSGDATPDDLSCDYDNMAVN
PSESGFVTLASMESGFVTNDIYEFSPDRMGRSRECGWVENEIYGY
Download sequence
Identical sequences ENSDORP00000008474 ENSDORP00000008474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]