SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008605 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008605
Domain Number 1 Region: 10-180,282-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.18e-49
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008605   Gene: ENSDORG00000009160   Transcript: ENSDORT00000009161
Sequence length 484
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2064:6887:36394:1 gene:ENSDORG00000009160 transcript:ENSDORT00000009161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSQAERKKIIVIGGGLVGALNACFLAKRNFQVEIYEVREDIRVAQSVRGRSINLALSY
RGRQALKAIGLEDQVVSQGVPMRGRMIHSLSGKRSVIPYGTKSQYILSISRKNLNKDLLT
AVEKYPNAKVHFGHRLVKCSPEEGMVTVLGPDNVPKDVTCDLIVGCDGAYSTVRSHFMRK
PRFDYSQQYIPHGYMELTIPPKCGEYAMEPNYLHIWPRNTFMMIALPNMEKSFTCTLFMP
FDEFEKLLTSNDVLDFFQKYFPDSIPLIGEQALVQDFFLLPAQPMIAIKCSSFHLKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDFSMCLPEFSRFRIPDDHAISDLS
MYNYVEMRSHVNSLWFIFRKNLERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQNK
VINKGLCMFGSLVAIGSAYLLVQHLSWRPLHYLRLPWNWTAYSCNMARFPSNSMQSLQIL
PFTG
Download sequence
Identical sequences ENSDORP00000008605 ENSDORP00000008605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]