SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008607 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008607
Domain Number 1 Region: 452-562
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.04e-36
Family GDI-like 0.00000401
Further Details:      
 
Domain Number 2 Region: 5-63
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.28e-16
Family GDI-like N domain 0.00017
Further Details:      
 
Domain Number 3 Region: 379-451,563-618
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000874
Family GDI-like N domain 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008607   Gene: ENSDORG00000009163   Transcript: ENSDORT00000009163
Sequence length 657
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2064:61032:63910:-1 gene:ENSDORG00000009163 transcript:ENSDORT00000009163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFPGLLSWLE
ELQQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXQYGQGEIPQCFCRMCAVFGGIYCLRHKIKCLVVDKGSRRCK
AIIDHFGQRINAEYFIVEDSYLSREICSNVQYKQISRAVLITDQSILQTDSDQQISILVV
PPEEPGACSVRVTELCSSTMTCMKDTYLVHLTCSSLKTAREDLEPVVKKLFSPFAEAEAD
EEGLKKPRLLWALYFNMRDSSGVSRSAYHGLPSNVYVCSGPDCGLGNEHAVKQAETLFHE
IFPSEEFCSPPPNPEDIIFDGDDKQLDAPGTDNTEMAKLEDGEESKNLENAGQHPQT
Download sequence
Identical sequences ENSDORP00000008607 ENSDORP00000008607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]