SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008634 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008634
Domain Number 1 Region: 122-265
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.94e-17
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008634   Gene: ENSDORG00000009191   Transcript: ENSDORT00000009192
Sequence length 571
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5798:105242:123105:1 gene:ENSDORG00000009191 transcript:ENSDORT00000009192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFVTLANKELLLCVLVFLTLGLVLSYRYRHRSGGLLGLQLSG
SQFAIFDVLSALPLVGFFWAKSPPGAEKKGQLESRRCRKGISMSETTSLGAATSMATSLN
DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGELLQPGGYEALKDLGLGD
TVDGFDAQVVNGYIVHNHESKSEVQIPYPLSDDKQVLNGKAFHHGKFIMSLRKAAMAEPN
ANFIEGVVLQLLEEDDTVGQYKDKETGEVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXHLKESFLEATQNSRMRSMPASFLPPSPVNKRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXAKKSFYWSRKSSHSFVVNVLAQALYELFSATDDSL
HQLRKACFLYFKLGGECVAGPVGLLSVLSPKPLVLIGHFFAVAVYATYFCFKSEPWITKP
RALFSSCMVLYKACAVIFPLIYSELRYVVHQ
Download sequence
Identical sequences ENSDORP00000008634 ENSDORP00000008634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]