SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008642 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008642
Domain Number 1 Region: 453-529
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 6.93e-19
Family Blood coagulation inhibitor (disintegrin) 0.00035
Further Details:      
 
Domain Number 2 Region: 251-332
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000373
Family Reprolysin-like 0.0078
Further Details:      
 
Domain Number 3 Region: 391-438
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000806
Family Reprolysin-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008642   Gene: ENSDORG00000009198   Transcript: ENSDORT00000009200
Sequence length 905
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1441:174358:348291:1 gene:ENSDORG00000009198 transcript:ENSDORT00000009200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAAAAPVPFLLLCALGTCPLARCGRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLTHVDRASFQVDAFGTSFILDVLLNXXXXXXXXXXXXX
XXXXXXXXXXGGEHCYYQGQIRGNPASFVALSTCHGLHGMFYDGNHTYLIEPEENDTSQE
DFHFHSVYKSRLFEFPLDDLPSEFQQINITPPKFIVKPRPKRSKQQXXXXXXXXXXXXXX
XXXXXXXXXXXFKKHRLSIVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWAADNKFA
ISENPMITLREFMKYRRDFIKEKSDAVHLFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECKCEDTWSGCIMGDTGYYLPKKFTQCNIE
EYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECILEGAECCKKCTLT
QDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGSSCDGVQG
ICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLC
GFLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDGDIGYVEDGTPCGPQ
MMCLERRCLPVASFNFSTCLSNKEGTICSGNGVCSNELKCVCNRDWIGADCNTYFPHKDN
GNAGIILSGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRQLPQGDYVKKPGD
GDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQARGG
NRKKIXXXXXXXXXXXXXTLSPAKSPSSSTGSIASSRKYPYPMPPLPDEEKKVNRQSARL
WETSI
Download sequence
Identical sequences ENSDORP00000008642 ENSDORP00000008642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]