SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008659 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000008659
Domain Number - Region: 283-326
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.017
Family Frizzled cysteine-rich domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008659   Gene: ENSDORG00000009218   Transcript: ENSDORT00000009217
Sequence length 343
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2620:7627:26848:1 gene:ENSDORG00000009218 transcript:ENSDORT00000009217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWGAWMWPEKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADH
LWLCAGARPRARELSSAMRPPWGAGRERPPVPPRALQPPPSSLGEPRAPPGSCSPRYSNL
TKAAPAAGPGPVCGGIPEPTGLDAACTKLESLQRLFEPTTPAPPLRPPDSPSRAPAEFPS
AKKNLLKGHFRNFTLSFCDTYSVWDLLLGMDRPDSLHCSLDTLLGDLLAVVASPGSGTWE
ACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFSV
TQQECQRWVPCKQYCLEVQTRCPFILPDNEEMVYGGLPGFICT
Download sequence
Identical sequences ENSDORP00000008659 ENSDORP00000008659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]