SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008670 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008670
Domain Number 1 Region: 263-514
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-71
Family Eukaryotic proteases 0.00028
Further Details:      
 
Domain Number 2 Region: 169-274
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-17
Family Hepsin, N-terminal domain 0.078
Further Details:      
 
Domain Number 3 Region: 134-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008670   Gene: ENSDORG00000009229   Transcript: ENSDORT00000009228
Sequence length 518
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4413:14569:33007:-1 gene:ENSDORG00000009229 transcript:ENSDORT00000009228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLPAGLLEAQILSSLTGSPLCEPGEDCVYEKLLIPPPPSTLGPGHHEVEVEVEASPRGP
EIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVVPDADAVAAQILSLLPLKFFPIIVVGL
IALILALAIGLGIHFDCSGKYRCRSSFKCIELTARCDGVSDCKDGEDEFRCVRVSGRNAA
LQVFVSASWRTVCADDWKGHYATIACVQLGFPSYVSSDSLRVDMLEEQFQVDFVSINHLL
PDDKVTTLHHSVYLREGCASGHVVTVKCTVCGQRTGYSPRIVGGNMSALAQWPWQASLQF
QGYHLCGGSVVTPLWIVTAAHCVYDLYLPKSWTVQAGLVSLLDSPAPSHLVEKIIYHSKY
KPKRLGNDIALMKLAGPLTFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDASPV
LNHAAVPLLSNKLCNHREVYGGLISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLV
GATSFGMGCAEVNKPGVYTRITSFLDWIHEQMERDLKT
Download sequence
Identical sequences ENSDORP00000008670 ENSDORP00000008670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]