SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008684 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008684
Domain Number 1 Region: 38-168
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000231
Family Ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008684   Gene: ENSDORG00000009242   Transcript: ENSDORT00000009243
Sequence length 983
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2810:92044:207044:-1 gene:ENSDORG00000009242 transcript:ENSDORT00000009243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKSYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLSCKGIRCEKQNNAFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXDHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLVKWIWTHLCKKKMRRKPESFGTIGVRTQHRRAADNLRRHHQYQEVMRNLVK
RYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSASATKESSNSA
DSDEKSDSEGHGKDKKKNLSLFDLTTLIHPRSAAIASERRTISNGSALAVQGPPREKQRK
VNFVADIKHFGLFHRRPKQSTAEPTTNPIFSVSEEVARQQAAAGPSESGIALGSRGLGAR
GDPNLPGLSEQCVLVDHRERNSDSLGVQMSKRVCAFTSEKVVVEDTVPIIPKEKHARDED
ASLDYDLHLKDTVSHEDYVTTRL
Download sequence
Identical sequences ENSDORP00000008684 ENSDORP00000008684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]