SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008697 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000008697
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000879
Family AN1-like Zinc finger 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008697   Gene: ENSDORG00000009257   Transcript: ENSDORT00000009256
Sequence length 153
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4179:4691:29026:-1 gene:ENSDORG00000009257 transcript:ENSDORT00000009256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATRAKKVKMATKSCPECDQQVPVACKSCPCGYIFISRKLLNAKHSEKLPPSTENKHEA
KRRRTERRKEKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSASAKKHEEEREKQEKE
IDIYANLSDEKAFVFSVALAEINRKIINQRLIL
Download sequence
Identical sequences ENSDORP00000008697 ENSDORP00000008697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]