SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008708 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008708
Domain Number 1 Region: 58-164
Classification Level Classification E-value
Superfamily PUG domain-like 0.000000000000929
Family PUG domain 0.0038
Further Details:      
 
Domain Number 2 Region: 695-760
Classification Level Classification E-value
Superfamily RING/U-box 0.000000152
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 858-930
Classification Level Classification E-value
Superfamily RING/U-box 0.0000165
Family RING finger domain, C3HC4 0.049
Further Details:      
 
Domain Number 4 Region: 351-376
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000366
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008708
Domain Number - Region: 572-610
Classification Level Classification E-value
Superfamily UBA-like 0.000232
Family UBA domain 0.012
Further Details:      
 
Domain Number - Region: 299-326
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000243
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Domain Number - Region: 408-432
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00196
Family Ran binding protein zinc finger-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008708   Gene: ENSDORG00000009267   Transcript: ENSDORT00000009267
Sequence length 1069
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3331:23509:39148:1 gene:ENSDORG00000009267 transcript:ENSDORT00000009267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEEERAVLAAREELASALRRDSGQSFSLEQLQPLLATSLPPAARYLQLDAARLVRCNA
LGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRTTVDAVQGGRDVLRL
YGYTEERPDGLSFPEEQEEPDEHQVATVTLEVLLLRTELSLLLQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSPGPCFLCGSAPATLYCPACKQASCPACD
LLFHGHPSRAHHLRQTLPRTPQAAHLSPSLPASSHPRPHSTSLLALGGSSLSSPDPGSNH
LLWHCAACTMLNEPWAVLCVACKRPRGCKVLGIGTEGVQGSGDLEPELARGQWACQSCTF
ENEAAAVLCAICERPRLAQPPSLVMDSQDAGICLQPLKQGDTLPSAQTQVWYCIHCTFCN
LGPGWVCAMCNRTSSPTPVQHAPVPCASLEKGLPKPGPPQRLGASMTSTSGNAEKQRQDK
MREEGLQLVLMIREGETAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQD
PGLGAFSCQEARKAWLDRHGNLDEAVEECVRARRRKVQELQSLGFGPEEGSLQALFQHGG
DVARALTELQRQRLEPFHQRLWDTGPEPAYSWDGPDKQSLVRRLLAVYALPSWGRAELAL
SLLQETPRNYELLDVIEAVRHSQDRAFLRRLLAQECAVCGWALPRNKMQALISCECTICP
ECFRQHFTIALKEKHITDMACPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHK
KLTEGVLMRDPKFLWCAQXXXXXXXXXXXXXXXXXXXXXXXXXXXKRQWEEQHRGRSCED
FQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYN
TFYAKNKCPDPKCKVKKSLHGHHPRDCLFYLRDWTAVRLQKLLQDNNIMFNTEPPAGARA
VPGGGCRVMEQKEVPNGLRDEACGKETPPGYAGLCQSHYKEYLVSLINAHSLDPATLYEV
EELEIATERYLHLHPQPLAGEDPPAYQARLLQKLMEEVPLGRSIPRRRK
Download sequence
Identical sequences ENSDORP00000008708 ENSDORP00000008708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]