SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008710 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008710
Domain Number 1 Region: 8-157
Classification Level Classification E-value
Superfamily C-type lectin-like 1.24e-27
Family C-type lectin domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008710   Gene: ENSDORG00000009271   Transcript: ENSDORT00000009269
Sequence length 157
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_23082:3348:9280:-1 gene:ENSDORG00000009271 transcript:ENSDORT00000009269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACKPMRLLFLLSCVASPEVLGDILRPSCASGWFYYNSSCYGYFRKLRNWSDAERECQSY
SNRSHLASVLSWREAGIMAKAIAGYQRIQPVWIGLHDPYQRQQWQWTDGAAYEYSAWKGR
XXXXXXXXXXXXXXXXFLTWNPNVCSQRHHFLCKYHP
Download sequence
Identical sequences ENSDORP00000008710 ENSDORP00000008710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]