SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008744 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008744
Domain Number 1 Region: 229-352
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-27
Family SPRY domain 0.00065
Further Details:      
 
Domain Number 2 Region: 6-75
Classification Level Classification E-value
Superfamily RING/U-box 7.28e-17
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 83-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000733
Family B-box zinc-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008744   Gene: ENSDORG00000009305   Transcript: ENSDORT00000009305
Sequence length 355
Comment pep:novel scaffold:dipOrd1:scaffold_5273:33614:34930:1 gene:ENSDORG00000009305 transcript:ENSDORT00000009305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDIVQAFPKELSCGICMNTFIEPVTLECGHSFCRPVFLCWEETPARCPGCKGPGQQTN
LKTNVVLRSLVAIARRARLRQFLSSEEYMCGTHRETKQMFCEVDRALLYRSCSMSQEHRA
HKHYPIERAADVQRKMISKQMHAVWEKTQENQHNLQEKRMTKDVFRMLQLFVQEEERHHS
QLLINEGRAMLQQLRERETMLQKKHQLRNMFLELIETYQKPDVELLQLNSEDSLHFTAFG
CQVFSSGKHYWDVSVDESSTWALGVVTDSVIGSNSVSEDVFLLLFVKENTLYTLFTTFPL
LSQYVEKPLGRVGVFLDLEHGSVSFWNVAKCSLIWRYPNDSLFPVRPLFSSGIPV
Download sequence
Identical sequences ENSDORP00000008744 ENSDORP00000008744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]