SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008745 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008745
Domain Number 1 Region: 3-48,85-197,292-330
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.04e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.042
Further Details:      
 
Domain Number 2 Region: 310-483
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000777
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008745   Gene: ENSDORG00000009306   Transcript: ENSDORT00000009306
Sequence length 528
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_101:5692:24436:1 gene:ENSDORG00000009306 transcript:ENSDORT00000009306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKRVAIVGAGVSGLASTKCCLEEGLEPTCFERSEDLGGLWRYTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKVCSVTKRPDFA
TSGQWEVVTLHEGKQSSATFDAVMVCTGFLTNPSVPLDSFPGIKTFKGQYFHSRHYKHPN
IFKDKRVLVVGMGNSGTDIAVEASHLAKKXXXXXXXXXXXXXXXXXXXXXXXXXFMTRFQ
NMIRNFLPTPIVSWLIAKKMNSWFNHENYGVIPEDRVQMREPVLNDELPGRIITGKVSIK
PSIKEVKENSVIFNNTPKEEPDIIICATGYTFDFPLEEVVKEDGQASLYKYFFPVHLRKP
TLAVINLIKPLGSMLPTGETQARWVVQVFKGTTLLPPASVMMKEVNERKENKPSGFGLCY
CKALQSDYIPYIDDLLTAINAKPSLWSMFLTDPRLACAVFFGPCTPYQFRLAGTGKWEGA
RQAILTQWDRALKVTKTRTVQKPPSAFDISLKLFGLLALLVAVFLVFL
Download sequence
Identical sequences ENSDORP00000008745 ENSDORP00000008745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]