SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008780 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008780
Domain Number 1 Region: 139-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.62e-62
Family Pancreatic carboxypeptidases 0.0000175
Further Details:      
 
Domain Number 2 Region: 1-120
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.92e-29
Family Frizzled cysteine-rich domain 0.0008
Further Details:      
 
Domain Number 3 Region: 463-542
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.92e-18
Family Carboxypeptidase regulatory domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008780   Gene: ENSDORG00000009339   Transcript: ENSDORT00000009342
Sequence length 610
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1649:1624:17226:1 gene:ENSDORG00000009339 transcript:ENSDORT00000009342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCVDLQLRTCADAAYNRTAFPTPLEHRSREAVEFSFEYILLGVLHHLLEGQCNPDLRLLG
CAVLAPRCEGGRVRRPCRRVCEGLREACRPAFDAIDMAWPYFLDCARYFAPEEDGCFDPL
MLLRGDLEIEEEPPSGLPPFIRFAHHSYAQMGRVLRRTAARCPEVARTYSIGRSFDGKDL
LVIEFSSRPGQHELLEPEVKLIGNIHGNEVAGRELLIYLAQYLCSEYLLGNPRIQRLLNT
TRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEFYRLASVRGAR
PDHIPIPQDYWWGKVAPETKAIMKWMRSTPFVLSASLHGGDLVVSYPFDYSKNPLQRKMF
SPTPDEKMFKLLARAYADVHPMMMDRSENRCGGNFLKHGSIINGADWYSFTGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHRGIKGVVMDKFGKPVKNAR
VLVKGIRHDITTAPDGDYWRLLPPGSHVVIAQAPGYAKVMKRVTIPLRMKRAGRVDFILQ
PLGTGPKKFLPALRRTAPQVPLLGPGPQGAPPEPDPPWVRRLPSAGGSKPWWWSYFTSLG
PHRPRWLLKY
Download sequence
Identical sequences ENSDORP00000008780 ENSDORP00000008780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]