SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008791 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008791
Domain Number 1 Region: 904-1066
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-32
Family Phosphotyrosine-binding domain (PTB) 0.0056
Further Details:      
 
Domain Number 2 Region: 7-27,70-135,269-285
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-22
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 695-763
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.34e-16
Family SAM (sterile alpha motif) domain 0.0034
Further Details:      
 
Domain Number 4 Region: 768-831
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000609
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008791   Gene: ENSDORG00000009353   Transcript: ENSDORT00000009353
Sequence length 1134
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_422:44421:212184:1 gene:ENSDORG00000009353 transcript:ENSDORT00000009353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEQELLEAARTGHLPAVEKLLSGKRLSSSFGGSGGGGGGGSAGGGGGGGGSGLGSSSH
PLSSLLSMWRGPNVNCVDSTGYTPLHHAALNGHKDVVEVLLRNDALTNVADSKGCYPLHL
AAWKGDAQIVRLLIHQGPSHTRVNEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDVNIKDNHGRTALDTVQELPSQKSQQIA
ALIKDHMTGKRSTKEIDKASTLQPSLLPSIDSAAQKSQGDVEKAVTELIIDFDTNAEEEG
PYETLYNAVSCHSLDSTASGRSSDRDSVNKEAEAAGARTAGMRPRERPPPPAKPPPDEEE
EDHLNKKYFPSTASEVLAMRPRIQGSAAREEDEHPYELLLTAETKKPASVDEKMKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVGEWLESIGLQQYESKLLL
NGFDDVRFLGSNVMEEQDLREIGISDAQHRRKLLQAARSLPKVKALGYDGNSPPSVTSWL
DSLGLQDYIHSFLASGYSSIDTVKNLWELELVNVLKVHLLGHRKRIIASLAERPYEEPPQ
KPPRFSQLRCQDLISQTSSPLSQNDSCAGRSADLLLPPGDTGWRRHDSLHDPTASSRERC
RVQEEPREAKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGTES
TQDACAKMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVIAEHEIRNISCAAQDPEDLC
TFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRTLGASAAE
MIETKSSKPVPKPRVGVRKSALEPPDTDQEAPSHASVSWIVEPKPDSKRSLSTN
Download sequence
Identical sequences ENSDORP00000008791 ENSDORP00000008791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]