SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008806 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008806
Domain Number 1 Region: 61-246
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000000000000216
Family Brix domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008806   Gene: ENSDORG00000009369   Transcript: ENSDORT00000009369
Sequence length 353
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_239:263797:272380:1 gene:ENSDORG00000009369 transcript:ENSDORT00000009369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATKRKRRGDLLVKAKKPKRDGKDAGKPAAQPGKAEEVEEEDRDCIPGPVCKGKWKNKE
RILIFSSRGINFRTRHLMQDLRKLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIFFEA
KKKQDLYMWLSNSPQGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDELPHYAL
LKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNL
IKIFQGSFGGPTLYENPHYQSPNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRKIQQKMNRGNAK
Download sequence
Identical sequences ENSDORP00000008806 ENSDORP00000008806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]