SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008889 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008889
Domain Number 1 Region: 4004-4141
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.49e-50
Family Fibrinogen C-terminal domain-like 0.000061
Further Details:      
 
Domain Number 2 Region: 2635-2720
Classification Level Classification E-value
Superfamily Fibronectin type III 2.13e-18
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 1447-1538
Classification Level Classification E-value
Superfamily Fibronectin type III 4.27e-18
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 2739-2929
Classification Level Classification E-value
Superfamily Fibronectin type III 4.34e-18
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 3823-3994
Classification Level Classification E-value
Superfamily Fibronectin type III 8.03e-18
Family Fibronectin type III 0.00000937
Further Details:      
 
Domain Number 6 Region: 3041-3130
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 7 Region: 3146-3236
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 8 Region: 3341-3425
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 9 Region: 789-877
Classification Level Classification E-value
Superfamily Fibronectin type III 2.67e-16
Family Fibronectin type III 0.0004
Further Details:      
 
Domain Number 10 Region: 2951-3033
Classification Level Classification E-value
Superfamily Fibronectin type III 3.48e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 11 Region: 1348-1430
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000193
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 12 Region: 3542-3622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000197
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 13 Region: 3251-3339
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000344
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 14 Region: 3637-3731
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000537
Family Fibronectin type III 0.00000367
Further Details:      
 
Domain Number 15 Region: 1245-1322
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000141
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 16 Region: 1552-1616
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000722
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 17 Region: 3762-3837
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 18 Region: 1965-2018
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000328
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 19 Region: 746-804
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000656
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 20 Region: 965-1030
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000805
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008889   Gene: ENSDORG00000009455   Transcript: ENSDORT00000009465
Sequence length 4142
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5113:7830:86821:-1 gene:ENSDORG00000009455 transcript:ENSDORT00000009465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPAQCPLTSSVVLLVLLGTAGAGPFSPRSNVTLPAPRPPPKPGGRTVGAGGGNPSQLYE
HTVEGGEKQVVFTHRINLPPSAGCGCPPGTEPPVPASEVQALRVRLEILEELVKGLKEHC
TGGCCPAAAQAGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXRVPSSASAYDQRGLAPGQDYQVTVRALRGTSWG
PPTSKTITTMIDGPQDLRVVAVTPTTLELSWLRPQAEVDRFVVSYVSAGNQRVRLEVPPE
ADGTLLTDLMPGVEYVVTVTAERGRAVSYPASVRANTEEGEEEEPRPGWSPPQSPGRPRG
NLTAELSRFRGSVQDLERHLRARGYPLRANQTYAAVARHLHDFLRRQVLGSSADGALLLS
LDGLRGHFERVVLRWRPQPPAEGPARELTVPGTARTVRLPDLSPGTTYHVEVHGVRAGQA
SKSYAFITTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHSEPSPGTPPRLGNLWVTDPTPD
SLRLSWTVPEGQFDSFMVQYRDDGPQVIPVEPERSVVVSPLDPDYKYRFTLFGIANERYG
PLTADGTTAPEMVKEPPRSEILEQPLLGELMVTDVTPDSLHLSWTVAQGPFDSFTVQYKD
AQGQPQAVPVRGDENEVTVPGLESNRKYKMNLYGLRGRQRVGPVSVVAKTAPEEETPSPT
EPSTEAPEPPVEPLLGELTVTGSSPDSLSLSWTVPQGHFDSFTVQYKDSDGRPQVVRVGG
QEREATVENLEPGRKYKMHLYGIYQGRRVGPVSTVATTDQQAEVIPPATEPPLEPRLGDL
TVTDVTPSSVSLSWTVPEGQFDSFMVQYKDRDGQLQEVPVAGDELEVTVPNLEPARXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXHNKRVGPLSAIATTDSREKYEAETKVPSPPVAVPRLGQLTVEEAMPDSLHLS
WMVPEGQFDSFEVQYTDRDGQLQVVSIEGDQTDITLTDESEHRYLVLYGFHDGKRVRPVQ
IAVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVATTVLPQVE
GSTEPIWVPNSLEQLLLEELTVADSPDLSTSQGCFEQAVSTQAVPTTTPESPPKPRLGEL
TVTDATPDSLSLSWTVPEGQFDHFLLQYRNGDGQPKVVRVPGHEDQVTISGLEPDHKYKM
NLYGFHSGQRTGPVSAIGVTATEEETPSPTEPSTEAPEPPEEPRLGELTVTGSSPDSLSL
SWTVPQGHFDSFAVQYKDSDGRPQVVRVGGQEREATVENLEPGRKYKMHLYGIYQGRRVG
PVSTIGNTVPTTTPEPPPKPRLGELTVTDATPDSLGLSWTVPEGQFDHFLLQYRNGDGQP
KVVRVPGHEDQVTISGLEPDHKYKMNLYGFHSGQRVGPVSAIGVTATEEETPSPTEPSTE
APEPSEEPLLGKLTVAGSSPDSLSLSWTVPQGHFDSFTVQYKDSDGRPQVVRVGGQEREA
TVENLEPGRKYKMHLYGIYQGQRVGPVSAIGNTVPTTTPEPPPKPRLEELTVTDATPDSL
GLSWTVPEGQFDHFLLQYRNGDGQPKVVRVPGHEDQVTISGLEPDHKYKMNLYGFHSGQR
VGPVSAIGVTXXXTPSPTEPSTEAPEPPEEPRLGELTVTGSSPDSLSLSWTVPQGHFDSF
AVQYKDSDGRPQVVRVEAEEREATIGDLEPGRKYKMHLYGVHQGQRVGPVSTVGVTASLP
TQPPVEPRLGELAVAEVTSDTVRLYWTVAQGLFDSFLVQYKDAHGQPQTVPVSRDLREAT
ISGLDPSRKYKFLLFGLQDGKRRGPISVEAKTMPDTKPSPRLGELTVTDVTTDSVGLSWT
VPEGEFDSFLVQYKDRDGQPQVVPVAADQREVTVPSLEPHRKYKFLLYGLAGRKRLGPIS
AEGTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEEAMPTPEGSEPSEAPRLG
LLTVTKATPDSLGLEWSVTQGPFDSFVVQYQDTDRQTQALLVDGDQNQVLISGLEPSTSY
KFFLYGLHEGKRQGPISAEGITGSAPAGQTPGDPGPRLSQLSVTDVTTISLRLNWEAPLG
AFDSFLLRFGVPSPRTLEPHPRPLLQRELVVPGTRRTAILRDLRPGTLYSLTLYGLRGPH
KADSIQGTARTLSPXXXXXXXXXXXXXXXXXXXXXXXXXXSRVDSFKVSYQLADGGEPQS
VQVDGRAQSQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLTTVPDGPTQLRALNLTEGS
ALLHWKAPQNPVDAYNVQVSAPGAPSLQASAPGSAVDYPLRDLVTHINYTATVRGLRGPN
FTSPASITFTTGLKAPQDLEAKDVTPRTALLTWTEPQVSPTGYLLSFDTPGGQTQEILLP
AGVTSHRLLRLYPSTLYNARLQAVWGESLTPPVSTSFTTGGLRVPFPRDCGEEMQNAPST
SRTTTVFLNGNRERPLDVFCDMETDGGGWLVFQRRMNGKTDFWRDWEEYAHGFGNISEEF
WLGNEALHSLTQSGDYSMRVDLRTRDEAVFAQYDSFQVDSAAENYRLHLEGYHGTAGDSM
SY
Download sequence
Identical sequences ENSDORP00000008889 ENSDORP00000008889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]