SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008899 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008899
Domain Number 1 Region: 88-299
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.62e-78
Family Fibrinogen C-terminal domain-like 0.00000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008899   Gene: ENSDORG00000009474   Transcript: ENSDORT00000009475
Sequence length 299
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6136:44104:49221:-1 gene:ENSDORG00000009474 transcript:ENSDORT00000009475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLQWTPFCLLLLLVLGPAYLKTQDHLSCPEPKELEASKVVVLSSCPGAPGSPGEKGVPG
PQGPPGPPGEMGPQGEPGDPSSLLRCQEGPRSCQELLSHGATLSGWYQVCLPVGRALWVY
CDMDTTGGGWLVFQRRQDGSVDFFQSWSSYKAGFGNQASEFWLGNENLYQLTLQGTWQLR
VELEDYHGNRTFAHYAAFHLLGEVDHYQLVLGKFLEGTAGDSLSFHSGKPFSTYDADHDL
SKSNCAVTVHGAWWYASCYRSNLNGRYAMSEATAHKYGIDWASGRGVGHPYRRVQMMLR
Download sequence
Identical sequences A0A1S3GRA3
ENSDORP00000008899 XP_012891351.1.60039 ENSDORP00000008899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]