SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008905 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008905
Domain Number 1 Region: 647-717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-25
Family Thrombospondin C-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 1-45
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 2.88e-16
Family Assembly domain of cartilage oligomeric matrix protein 0.00015
Further Details:      
 
Domain Number 3 Region: 241-322
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000994
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 4 Region: 311-375
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000353
Family TSP type-3 repeat 0.00056
Further Details:      
 
Domain Number 5 Region: 146-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000249
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008905
Domain Number - Region: 104-239
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008905   Gene: ENSDORG00000009481   Transcript: ENSDORT00000009481
Sequence length 730
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1431:7647:12810:-1 gene:ENSDORG00000009481 transcript:ENSDORT00000009481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDLAPQMLRQLQETNEALRDVRELLRQQVKEITFLKNTVMECDACXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTAHPCFPRVRCVNTSP
GFRCEACPPGYSGRTHEGVGLAFARASKQVCTDINECETGQHNCVPNSVCINTRGSFQCG
PCQPGFVGDQASGCQRSSQRSCPDGSPSPCHEKADCVLERDGSRTCVCAVGWAGNGLLCG
RDTDLDGFPDEKLRCSERHCRKDNCVTVPNSGQEDVDRDGVGDACDPDADGDGVPNEQDN
CPLVRNPDQRNSDSDKWGDACDNCRAQKNDDQKDTDRDGRGDACDDDIDGDRIRNEADNC
LRLLNADQKDSDRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAWKDKMSYRWFLQ
HSAQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPE
DYEAQRLRRA
Download sequence
Identical sequences ENSDORP00000008905 ENSDORP00000008905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]