SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008958 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008958
Domain Number 1 Region: 429-460,542-616
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000667
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008958   Gene: ENSDORG00000009535   Transcript: ENSDORT00000009535
Sequence length 664
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1446:22173:41839:-1 gene:ENSDORG00000009535 transcript:ENSDORT00000009535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAFALLVNIPPRYGLYAAFFPVITYFFLGTSRHISVGPFPVLSMMVGAVVTRMVPDASTN
MEFTNSSMSNESLLEEKKIMEGALTILGIMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXYSLYDYPIDGNQELIALGMNNIFAGSFQGFAGSTALSRS
GVQESTGGKTQVAGIVSGVIVLIVIVAIGFLLQPLQKSVLXXXXXXXXKGMLMQFAEIGR
LWRKDKYDCLIWIMTFIFAIVLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIY
KNKKDYSDMYEPEGVKIFRCPSPIYFANIGFFKQKLTDAVGFSPLRILRKRNKALKKIRK
LQKRGLLQVTPKGFICTAEGLKDSDEELDNNQIEELDQPINTTDLPFEIDWNADLPLNIV
VPKISLHSLILDFSAVSFLDVSSMRGLKTILQEFIRIKVDVYIVGTDDDFIEKLTRCEFF
DDEVTDSIFFLTIHDAVLHILMKKDYNTSKFNSSQKKETKFDFTINTNGGLRNRECQVPM
ETKF
Download sequence
Identical sequences ENSDORP00000008958 ENSDORP00000008958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]