SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008961 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008961
Domain Number 1 Region: 15-253
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.75e-83
Family Eukaryotic proteases 0.00000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008961   Gene: ENSDORG00000009538   Transcript: ENSDORT00000009538
Sequence length 254
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_24038:4781:9146:1 gene:ENSDORG00000009538 transcript:ENSDORT00000009538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLAFFLLASAAARDGDKVLEGEECPPHSQPWQVALYERGRFNCGASLISPRWVLSAAH
CQTRFMSVHLGEHNLRKHEGPEQLRAVLRTIPHPGYEPRSHLHDIMLLRLARPVNLTPQV
RPLALPTRCPHPGEACVVSGWGLVSDNESGTTGSPTSQVSLPDTLHCANISIIPDTSCNK
DYPGRLRDTMVCAGVEGGGTDSCEGDSGGPLVCGGVLQGVVSWGDVPCDTTTKPGVYSKV
CCYLDWIRETMRRN
Download sequence
Identical sequences ENSDORP00000008961 ENSDORP00000008961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]