SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008975 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008975
Domain Number 1 Region: 117-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.07e-20
Family Clostridium neurotoxins, the second last domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008975   Gene: ENSDORG00000009552   Transcript: ENSDORT00000009552
Sequence length 754
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3291:214:14094:1 gene:ENSDORG00000009552 transcript:ENSDORT00000009552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIENTEKLQYSGEKLYKFTVTAYDCGKKRAADDAEVEIQVKPTCKPSWQGWNKRIEYTPG
AGSLALFPGIRLETCDEPLWNIQATIELQTSHVGKGCDRDNYSERALRKLCGAATGEVDL
LPMPGPNANWTAGLSVQYSQDSSLIYWFNGTQAVQVPVGSPAGPGSAPIDGLSDHFTLSF
WMKHGVSPSKGKKEEETILCHTVQNEDGFSHYSLTVHGCRIAFLYWPLLDSARPVKFLWK
LEQVCDDGWHHYALNLEFPTVTLYTDGISFDPALIHDNGLIHPPRRDPALMIGACWTEEN
KKEKGDNATEAAPGDPLPVHHYFHGYLAGFSVRAGHLENRAVIQCLYACREGLDYRDFEN
LGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVDYMNTLRFATPGVRPLRLTTAVKCFSE
ESCVSIPEVEGYVVVLQPDAPQILLSGTSHFARPAADFEEPDGVPLFPDLQITCSISHQV
EAKGDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLLLDTASAQQRGLELTN
TSAYLTIAGVESITVYEEILRQARYRLQRGAALYARKFRLSCSEMNGRYSSNEFVVEVNV
LHSMNRVAHPSHVLSSQQFLHRGHQSPHMAGLMLDSGHRNSMVPSAATLIIVVCVSFLLL
MVILGLVRIHSLHCRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPMESYHNPQAGVAG
GPAGQEEEDSSDSEAADSPAGDERRIIETPPHRY
Download sequence
Identical sequences ENSDORP00000008975 ENSDORP00000008975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]