SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008990 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008990
Domain Number 1 Region: 134-219
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.000000118
Family Dual specificity phosphatase-like 0.0096
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000403
Family Cell cycle control phosphatase, catalytic domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008990   Gene: ENSDORG00000009567   Transcript: ENSDORT00000009567
Sequence length 219
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2531:1970:14887:-1 gene:ENSDORG00000009567 transcript:ENSDORT00000009567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASELLFCEPTKLYNILNQATKLSRLTEPNYLYLFXXXXXXXXXXXXXXXXXXXXXKENQ
YLVPESVDLDCVRYCVVYDKNTTSLEVRLRLEPGPAVQFGRVLIHLTRYPVYVLRGGYEH
FTSLYHFLRTQKIIWMPQELEAFEPYPIEIVPGHIYLGSYKQACDPKIKKDLKIKAHVNV
SMESTPFFQEDPDYLLHVKIEDDPEANIIPFLRPICHFL
Download sequence
Identical sequences ENSDORP00000008990 ENSDORP00000008990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]