SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009016 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009016
Domain Number 1 Region: 14-107,141-284
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.7e-45
Family Ankyrin repeat 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009016   Gene: ENSDORG00000009596   Transcript: ENSDORT00000009595
Sequence length 301
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3431:94637:140948:-1 gene:ENSDORG00000009596 transcript:ENSDORT00000009595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGKSSFQKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVASYAGHID
CVRELVLQGADINLQRESGTTALFFAAQQGHNEVVRFLFGFGASTECRTKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDGATALFLAAQGGYLDVIRLLLSSGAKVNQPRQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGTTALLKAANKGYSDVIQELLKFSPTLGIL
KNGTSALHAAVLSGNIKTVALLLEAGADPALRNKANELPAELTKNEHILHLLRSKEGHRK
S
Download sequence
Identical sequences ENSDORP00000009016 ENSDORP00000009016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]