SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009048 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009048
Domain Number 1 Region: 174-392
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.77e-57
Family Leukotriene A4 hydrolase catalytic domain 0.0019
Further Details:      
 
Domain Number 2 Region: 96-167
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 9.81e-28
Family Leukotriene A4 hydrolase N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009048   Gene: ENSDORG00000009627   Transcript: ENSDORT00000009628
Sequence length 799
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3413:1077:36936:1 gene:ENSDORG00000009627 transcript:ENSDORT00000009628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRQATNQIVMNCADIDIITASYAPEGDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATDARRAFPCWDEPAIKATFDISLV
VPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVC
VRVYTPVGKAEQGKFALEVAAKTLPFYKEYFNVPYPLPKIDLIAIADFAAGAMENWGLVT
YRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLC
VDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDFKKGMNMYLTKFQQKNAATENVEDDRLLRLSQKKFCASGPYVXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNLG
ILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHKA
TLEEARRRFKDHVEGKQSLSADLRSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXATLSPELIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN
RYQGGFLISRLIKXXXXXXXXXXXXXXXXAFFESHPAPSAERTIQQCCENILLNAAWLKR
DADSIHQYLLQRKASPPAV
Download sequence
Identical sequences ENSDORP00000009048 ENSDORP00000009048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]