SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009074 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009074
Domain Number 1 Region: 219-416,476-529
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.56e-65
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000122
Further Details:      
 
Domain Number 2 Region: 54-218
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.19e-46
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00026
Further Details:      
 
Domain Number 3 Region: 509-613
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.03e-22
Family Anticodon-binding domain of Class II aaRS 0.0014
Further Details:      
 
Domain Number 4 Region: 7-53
Classification Level Classification E-value
Superfamily TGS-like 0.000000000107
Family TGS domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009074   Gene: ENSDORG00000009653   Transcript: ENSDORT00000009655
Sequence length 625
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5977:31320:55312:-1 gene:ENSDORG00000009653 transcript:ENSDORT00000009655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVEGQMWKTTPYHLAAGISQEVAESMVIAKVNGELWDLDRPLEGDSTLELLTFDSEEAQA
VYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELAALESMCKTIIK
EKQPFERLEVSKETLLEMFKXXXXXXXXXKEKVNTPTTTVYRCGPLIDLCKGPHVRHTGK
IKTIKLFKNSSTYWEGNSEMEILQRIYGIFPDNKMMDWEKFEEAKNRDHRKIGKEQELFF
FHDLSPGSCFFLPRGAFIYNTLMDFIREEYHKRDFTEVLSPNIYNSKLWEASGHWQNYSE
NMFTFDIEKDTFALKPMNCPGHLMAHRPRSWREMPLLADFGVLHRNELSGTLSGLTRVRR
FQQDDAHIFCTVEQIEEEIMGCLQFLQSVYSTFGFSFQLNLSTRPENFLGDTELWDEAEK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
KDGDDKKRPVIIHRAVLGSVERMIAILAENYAGKWPFWLSPRQVMVIPVGPTCEKYAFQV
SNEFFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVFGEKEKINNAVNRTRDNKFHEE
ISVASAIDKLKNLQQLRVLNAEEDF
Download sequence
Identical sequences ENSDORP00000009074 ENSDORP00000009074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]